PDB entry 6pax

View 6pax on RCSB PDB site
Description: crystal structure of the human pax-6 paired domain-DNA complex reveals a general model for pax protein-DNA interactions
Class: gene regulation/DNA
Keywords: pax, paired domain, transcription, protein-DNA interactions, gene regulation/DNA complex
Deposited on 1999-04-22, released 1999-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homeobox protein pax-6
    Species: Homo sapiens [TaxId:9606]
    Gene: PAX6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26367 (0-132)
      • conflict (24)
      • conflict (58)
      • conflict (88)
    Domains in SCOPe 2.07: d6paxa1, d6paxa2
  • Chain 'B':
    Compound: 26 nucleotide DNA
  • Chain 'C':
    Compound: 26 nucleotide DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6paxA (A:)
    shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
    gsirpraiggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssi
    nrvlrnlasekqq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.