PDB entry 6pap

View 6pap on RCSB PDB site
Description: hydrolase (sulfhydryl proteinase)
Deposited on 1976-10-01, released 1976-10-01
The last revision was dated 1976-10-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: BZO

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >6pap_ (-)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn
    

  • Chain 'p':
    No sequence available.