PDB entry 6pai

View 6pai on RCSB PDB site
Description: Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and sulfonamide E7820
Class: ligase
Keywords: sulfonamide, RBM39, DCAF15, LIGASE
Deposited on 2019-06-11, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA damage-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: DDB1, XAP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16531 (Start-1139)
• Chain 'C':
  Compound: DDB1- and CUL4-associated factor 15
  Species: Homo sapiens [TaxId:9606]
  Gene: DCAF15, C19orf72
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q66K64
  • Uniprot Q66K64 (Start-497)
• Chain 'D':
  Compound: RNA-binding protein 39
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp781I1140
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z3L0
  Domains in SCOPe 2.08: d6paid_
• Chain 'E':
  Compound: DET1- and DDB1-associated protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: DDA1, C19orf58, PCIA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BW61
• Heterogens: EPE, O6M, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >6paiD (D:)
  gshmaaamannlqkgsagpmrlyvgslhfnitedmlrgifepfgriesiqlmmdsetgrs
  kgygfitfsdsecakkaleqlngfelagrpmkvghvtertddykddddk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6paiD (D:)
  gpmrlyvgslhfnitedmlrgifepfgriesiqlmmdsetgrskgygfitfsdsecakka
  leqlngfelagrpmkvghvt
  

  
  
• Chain 'E':
  No sequence available.