PDB entry 6p9d

View 6p9d on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f variant with fad - yellow fraction
Deposited on 2019-06-10, released 2020-06-17
The last revision was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-dependent catabolic D-arginine dehydrogenase DauA
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: dauA, PA3863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXE3 (0-374)
      • engineered mutation (248)
  • Heterogens: GOL, FDA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6p9dA (A:)
mieadylvigagiagastgywlsahgrvvvlereaqpgyhstgrsaahytvaygtpqvra
ltaasraffdnppagfcehpllsprpemvvdfsddpeelrrqyesgkalvpqmrlldaeq
acsivpvlrrdkvfgatydptgadidtdalhqgylrgirrnqgqvlcnhealeirrvdga
wevrcdagsyraavlvnaagawcdaiaglagvrplglqpkrrsafifapppgidchdwpm
lvsldesfflkpdagmllgspanadpveahdvqpeqldiatgmylieeattltirrpeht
waglrsfvadgdlvagyaanaegffwvaaqggygiqtsaamgeasaalirhqplpahlre
hgldeamlsprrlsp