PDB entry 6p6o

View 6p6o on RCSB PDB site
Description: HCV NS3/4A protease domain of genotype 1a D168E in complex with glecaprevir
Class: VIRAL PROTEIN, Hydrolase
Keywords: HCV NS3/4A protease HCV protease domain Glecaprevir, GLE Genotype 1a, VIRAL PROTEIN, Hydrolase
Deposited on 2019-06-04, released 2020-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 4A,Serine protease NS3
    Species: Hepatitis C virus genotype 1a (isolate 1) [TaxId:11104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26664 (10-20)
      • expression tag (0-9)
      • engineered mutation (11)
      • engineered mutation (18-19)
      • linker (21-23)
    • Uniprot P26664 (24-201)
      • engineered mutation (33-34)
      • engineered mutation (37-38)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (67)
      • engineered mutation (72)
      • engineered mutation (92)
      • engineered mutation (100)
      • engineered mutation (106)
      • engineered mutation (188)
      • engineered mutation (194)
      • engineered mutation (201)
    Domains in SCOPe 2.08: d6p6oa1, d6p6oa2
  • Heterogens: O31, ZN, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6p6oA (A:)
    gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
    tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
    gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavc
    trgvakavefipveslettmra