PDB entry 6p4z

View 6p4z on RCSB PDB site
Description: structure of gadolinium-caged cobalt (iii) insulin hexamer
Deposited on 2019-05-29, released 2019-06-12
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Insulin chain A
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: Insulin chain B
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
• Chain 'C':
  Compound: Insulin chain A
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: Insulin chain B
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (Start-29)
• Heterogens: CL, CO, GD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6p4zA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6p4zB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6p4zC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records:
  

  >6p4zD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6p4zD (D:)
  hlcgshlvealylvcgergffytpkt