PDB entry 6p4d

View 6p4d on RCSB PDB site
Description: Hen egg lysozyme (HEL) containing three point mutations (HEL3x): R21Q, R73E, and D101R
Class: hydrolase
Keywords: hen egg lysozyme HEL3x, HYDROLASE
Deposited on 2019-05-27, released 2020-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (20)
      • engineered mutation (72)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6p4da_
  • Heterogens: CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6p4dA (A:)
    kvfgrcelaaamkrhgldnyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsenlcnipcsallssditasvncakkivsrgngmnawvawrnrckgtdv
    qawirgcrl