PDB entry 6p08

View 6p08 on RCSB PDB site
Description: Ternary structure of the E52D mutant of ANT-4'' with Neomycin, AMP and Pyrophosphate
Class: transferase/antibiotic
Keywords: Aminoglycoside nucelotidyl transferase (ANT), Aminoglycoside modifying enzymes (AGMEs), DNA polymerase, ANTIBIOTIC, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2019-05-16, released 2020-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kanamycin nucleotidyltransferase
    Species: Bacillus sp. [TaxId:1409]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05058 (Start-255)
      • engineered mutation (54)
    Domains in SCOPe 2.08: d6p08a1, d6p08a2
  • Chain 'D':
    Compound: kanamycin nucleotidyltransferase
    Species: Bacillus sp. [TaxId:1409]
    Gene: knt, kan
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05058 (Start-255)
      • engineered mutation (54)
    Domains in SCOPe 2.08: d6p08d1, d6p08d2
  • Heterogens: AMP, MG, NMY, PPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6p08A (A:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p08A (A:)
    ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee
    aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
    taksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhh
    ricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterh
    gyivdvskripf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6p08D (D:)
    gshmngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvm
    steeaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggyle
    kvyqtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamli
    glhhricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqew
    terhgyivdvskripf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6p08D (D:)
    ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdidmmcvmstee
    aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
    taksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhh
    ricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterh
    gyivdvskripf