PDB entry 6oyl

View 6oyl on RCSB PDB site
Description: The structure of the PP2A B56 subunit KIF4A complex
Class: hydrolase
Keywords: Ser/thr phosphatase, complex, HYDROLASE
Deposited on 2019-05-14, released 2020-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R5C, KIAA0044
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6oyla_
  • Chain 'B':
    Compound: Chromosome-associated kinesin KIF4A
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF4A, KIF4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95239 (Start-43)
      • engineered mutation (35-36)
      • engineered mutation (42-43)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6oylA (A:)
    ghmgsrdvppadqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrn
    vitepiypevvhmfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrfl
    espdfqpniakkyidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqin
    nifyrfiyetehhngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhp
    qlaycvvqflekdstltepvvmallkywpkthspkevmflneleeildviepsefvkime
    plfrqlakcvssphfqvaeralyywnneyimslisdnaakilpimfpslyrnskt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6oylA (A:)
    dqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevv
    hmfavnmfrtlppeaawphlqlvyefflrflespdfqpniakkyidqkfvlqllelfdse
    dprerdflkttlhriygkflglrayirkqinnifyrfiyetehhngiaelleilgsiing
    falplkeehkifllkvllplhkvkslsvyhpqlaycvvqflekdstltepvvmallkywp
    kthspkevmflneleeildviepsefvkimeplfrqlakcvssphfqvaeralyywnney
    imslisdnaakilpimfpslyrn
    

  • Chain 'B':
    No sequence available.