PDB entry 6oy8

View 6oy8 on RCSB PDB site
Description: Crystal structure of Y99G mutant of human macrophage migration inhibitory factor
Class: isomerase
Keywords: Isomerase, trimeric, mutation
Deposited on 2019-05-14, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d6oy8a_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d6oy8b_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d6oy8c_
  • Heterogens: SO4, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6oy8A (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinygdmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6oy8B (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinygdmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6oy8C (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinygdmnaanvgwnnstfa