PDB entry 6oud

View 6oud on RCSB PDB site
Description: Carbonic Anhydrase IX mimic complexed with benzene sulfonamide MB11-694B
Class: lyase/lyase inhibitor
Keywords: benzene sulfonamide, carbonic anhydrase, inhibitor, LYASE, LYASE-LYASE INHIBITOR complex
Deposited on 2019-05-04, released 2020-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • engineered mutation (61)
      • engineered mutation (63)
      • engineered mutation (65)
      • engineered mutation (87)
      • engineered mutation (126)
      • engineered mutation (165)
      • engineered mutation (199)
    Domains in SCOPe 2.08: d6ouda_
  • Heterogens: N7M, ZN, GOL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6oudA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
    lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk