PDB entry 6osw

View 6osw on RCSB PDB site
Description: an order-to-disorder structural switch activates the foxm1 transcription factor
Deposited on 2019-05-02, released 2019-05-29
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Forkhead box M1
    Species: Danio rerio [TaxId:7955]
    Gene: foxm1, foxm1l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T2G3
      • engineered mutation (68)
  • Chain 'B':
    Compound: Forkhead box M1
    Species: Danio rerio [TaxId:7955]
    Gene: foxm1, foxm1l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T2G3 (1-End)
      • engineered mutation (1)
      • engineered mutation (3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6oswA (A:)
gefmresprrpiilkrrklpfakstarsfpdgirvmdhptmpdtqvvvipksadlqsvis
vltakgkeagpqgrnkfillsgdtsaeeenlyfq

    Sequence, based on observed residues (ATOM records):
    >6oswA (A:)
girvmdhptmpdtqvvvipksadlqsvisvltakgkeagpqgrnkfillsgdts

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6oswB (B:)
gaqagaanrsltegfvldtmndslskilvdisfsglededlgmgniswsqfipeak

    Sequence, based on observed residues (ATOM records):
    >6oswB (B:)
aqagaanrsltegfvldtmndslsk