PDB entry 6osd

View 6osd on RCSB PDB site
Description: coiled-coil trimer with glu:phe:lys triad
Deposited on 2019-05-01, released 2020-04-29
The last revision was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Coiled-coil Trimer with Glu:Phe:Lys Triad
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 6OSD (Start-32)
• Chain 'B':
  Compound: Coiled-coil Trimer with Glu:Phe:Lys Triad
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 6OSD (Start-32)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6osdA (A:)
  evealekkvealefkvqklekkvealehgwdgr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6osdB (B:)
  evealekkvealefkvqklekkvealehgwdgr