PDB entry 6orb

View 6orb on RCSB PDB site
Description: full-length s. pombe mdn1 in the presence of atp and rbin-1
Deposited on 2019-04-29, released 2019-05-29
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 7.7 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Midasin
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: mdn1, SPCC737.08
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6orbA (A:)
    mdvliewvaiypqiydilehinyvpsntlqrlrlhqpwskidydvwflyasdeiretckv
    kyygetktygevfvlenerisqlhrlfvswtvseraehlknllfdaglsnlplvelggnv
    ffnshvplpcslvltkstqenlnritpylvqkrpillagpegigkkflitqiaaklgqqi
    irihlsdstdpkmligtytspkpgefewqpgvltqavitgkwilftniehapsevlsvll
    pllekrqlvipsrgetiyakgsfqmfatssmktkilgqrlwqildltyqpdecvevvstl
    ypvlsiicptlysvykdifdlfsqrsflatskiyrrlclrdfykfikrvaflyhkfmips
    dhvvisqelqdavfkeaidmfgafipsrdgfdlvvrnvaielnippekalqlrysipvfq
    nlehninigrcslkklstirscstnsyaftssslglleqlaagvqtneplllvgetgtgk
    tttiqllagllgqkvtvinmsqqtessdmlggykpinastlglplherfidifeqtfssk
    knakfismastsarrfrwktclkiwkeacklsktvldgqqplpnpqkrqkrlsnqvelrn
    qwakfekevedfekvltggsngfmfsfvegalvkavrsghwvlldeinlasletlepigq
    llssyesgillsergditpitphknfrlfgcmnpstdvgkrelepsfrsrfteiyvhspd
    qnlddllsiiqkyigslcignehvirevaelyqvakslsldgslvdgagqrphytvrtls
    rtlsyvteiapiyglrrslyegfcmsfltlldhtsesllynhvvrftlgelnrdqqnail
    kqipkvpdhssyiafchywlrrgsfpveeqehyiitpfvqknllniaracstrmfpiliq
    gptssgktsmieyvakktghkfvrinnhehtdlqeyigtyvtddngslsfregvlvealr
    ngywivldelnlaptdvlealnrllddnrelfipetqvlvkphpefmlfatqnppgvyag
    rkhlsrafrnrfleihfddipeneletilhkrckiapsyaakivqvfrelslrrqttrif
    eqknsfatlrdlfrwafreavgyqqlaengymllaerardqkdklavqeviekvmkvkid
    tdgiynldsmeifqdmslkegplskvvwtrpmirlfclvwrcllakepvllvgdtgcgkt
    tvcqilaeclhkelhiinahqdtengdiigaqrpvrnrsavnyslhsqlcekfnvqesld
    siddliekfeklsssekndnlsnlierqiikyrslfewhdgalvtamkqgdfflldeisl
    addsvlerlnsvlelsrtltlvehsnaavsltakdgfaffatmnpggdygkkelspalrn
    rfteiwvppmvdtedilkivegklhnnkielarplveyakwhaneylytdvisirdvlsa
    vefinaceildlnlvlfnavsmvfidalgsfttfslsnnlaslhaerqrcfaklnelags
    nimasksadisikfsdssffigdfgiplgdsvesdstyslhtdttlmnaskvlralqvlk
    pillegspgvgktslitalaretghqlvrinlsdqtdlmdlfgsdvpveggeggqfawrd
    apflaamrnghwvlldelnlasqsvleglnacldhrneayipeldkvfkahpnfrvfaaq
    npqhqgggrkglprsfinrfsvvyvealkekdmieiaacnyhqvnedwrlkiikfmfrlq
    dniekdisfgsfgspwefnlrdtlrwlqllndapkytcvspadylevmvlhrmrtvedrv
    rtcelfkevfdidyeprtigfslssqcfkvghsllvrdverqktlldsqnilqsqlpvle
    svitcinkkwpcilvgdtatgktcilrllaaiagakikemavnsdtdtmdligeyeqidi
    srkaselftdlsqqllnivikyrnfdnifretslytltttsfkthsqaftllqkvvdqld
    qlkihetlvhslgdihekarkllaefsaspagrfewfdgyllkaveeghwfvldnanlcs
    pavldrlnsllehkgvlivnekttedghpktikphpnfrlfltvnpvygelsramrnrgv
    eifllkealteidkkqmsllepapissavdtlasnisyikyvfetmgkieidgnymyiah
    aiilalfsprqlkllrkvlltnpqfslsikadaellltlknlvqkiycadyfnhmdlkas
    rfmdiyeypvqlrevvgliqtindfqsviltshlelpetyasgllfvsaheildlteevn
    rlavstsnstyllksasavyhnvssfkgstpslwnllnqfskflieiasansnivyklsy
    dvirhflklvvlwkniyvwtnvpdcdisrfycytkmlgewmftltektkllesflpkdsl
    ekfselqnlstglhmqaiwdkwhafvprtydqwslwntvdklltqyvnanipsismetta
    cevvgtslsllnkvlvenevgdiysylkilgkgvnelksskqvilpenlvnlfnclasld
    llhifikyttssffltddfvrfirvcfhsrisgnlltllhgisfdstkavapvltyfdfc
    slttgnilgrialaftsidenanlesanifeharlallqhfmdhssllaedsstkmnlil
    lqryaviisifldqgkcekandlitklslpyeelaenfvsileackaflvansefisyty
    terfihslrflkdswlssnqqkmlknqgmayiyfasgmllvyvpdkpfdpallplltves
    lrhyleslykesqileiaeslnsgkvnsvmrrlvsteisntpnidssfstvyrslnesiv
    plyseleffmksvvlnqyifelamrlskesniavveeaksfvtkwkayierireaypqfv
    dvyelilsfisfmiygiellmfeakrrldersqilstliltlvdpssfarslsfddvsnl
    ieqikvldlndsirfeiylflasrlcsekqhssdthslansfvllanefyihnakikqke
    leeieeknrlyrqrefnfdkndylkvfinyddevepevepevvierkrflqlqfafwsly
    neiysekmnvipleqlmntgsylakkikvknpdmiassgfdivsvvlmmgvkstnerqyw
    tppvynfysdpnpskaievrdlikivesraisliknwpenfvlrglkdaidailnlspfs
    piaeylsklervfhllseweklasreyslanemdlikkkiidwrkfelsnwnnllkleey
    klservyprlysilqfiilkpffenskftkqnlcesasiivqfitdltvgefqlclkcll
    sfsqhaaslrichgidamllniyhyfeqflskvseaihtqkqslensikerillmswkdt
    nvyalkesakkshaelfkvlhryrevlrqpvssylsqkhdwdslldtennsamwvakkvn
    lspsyiekmdteimklvpvrfsntpttlrlmwtlfanvekpgstftnmvsnlitdarelm
    kltpetinddnlseikhlksrkhllltetfktlkafglqyrvkagieenlsnlrnllavi
    ptfpvtslsiekvdrslmksldfipkfqtlaghqhndlsvpevqkgvglfnsmlslqlge
    raqlveftnellalknvysevgvngsplesfnnssfnevsslgydhdfenraqavsmlcq
    iyaiviqkhssisptasfqsighelsrfadllsnklfpssiplyasadkvssirdqqkgi
    ndlieycrkkrtelpelsycfkhlvslqslksisrtqvdltndeflnlmnfvlnlfdsll
    ssietatknmrtfkelaetssfiemsscfskvlrafnlkfqsmklsslkeklrsssvdkm
    scqllmlflpvceqfinlaesvldyfinvhnsnldslskistlffmvanngfcspdlpqe
    gksnsgelesgtglgsgvgaeditntlnedddleelaneedtanqsdldesearelesdm
    ngvtkdsvvsenensdseeenqdldeevndipedlsnslneklwdepneedlleteqksn
    eqsaannesdlvskeddnkaledkdrqekedeeemsddvgiddeiqpdiqennsqpppen
    edhldlpedlkldekegdvskdsdledmdmeaadenkeeadaekdepmqdfedpleennt
    ldediqqddfsdlaeddekmnedgfeenvqeneestedgvksdeeleqgevpedqaidnh
    pkmdakstfasaeadeentdkgivgeneelgeedgaaesgvrgngtadgefssaeqvqkg
    edtstpkeamseadrqyqslgdhlrewqqanrihewedltesqsqafddsefmhvkedee
    edlqalgnaekdqiksidrdesanqnpdsmnstniaedeadevgdkqlqdgqdisdikqt
    gedtlptefgsinqsekvfelsedediedelpdynvkitnlpaampideardlwnkheds
    tkqlsielceqlrlileptlatkmqgdfrtgkrlnmkriipyiasqfkkdkiwmrrvkps
    krtyqvmisiddsksmsesgstvlaletlalvtkalsllevgqiavmkfgeqpellhpfd
    kqfssesgvqmfshftfeqsntnvlaladasmkcfnyantashhrsnsdirqleiiisdg
    icedhdsirkllrraqeekvmivfvildnvntqkkssildikkvyydtkedgtmdlkiqp
    yidefafdyylvvrnieelpqllssalrqwfqqmsnt
    

    Sequence, based on observed residues (ATOM records):
    >6orbA (A:)
    dvliewvaiypqiydilehinyvpsntlqrlrlhqpwskidydvwflyasdeiretckvk
    yygetktygevfvlenerisqlhrlfvseraehlknllfdalplvelggnvffnslvltk
    stqenlnritpylvqkrpillaegigkkflitqiaaklgqqiirihlsdstdpkmligty
    twqpgvltqavitwilftniehevlsvllpllekrqlvipsrgetiyakgsfqmfatssm
    ktkilgqrlwqilyqpdecvevvstlypvlsiicptlysvykdifdlfsskiyrrlclrd
    fykfikrvaflyhkvfkeaidmfgafipsrdgfdlvvrnvaielnippekalqlssslgl
    leqlaagvqtneplllvgetgtgktttiqllagllgqkvtvinmsqqtessdmlggalvk
    avrsghwvlldeinlasletlepigqllsphknfrlfgcmnpepsfrsrfteiyvhdlls
    iiqkyigsnehvirevaelyqvakslsldphytvrtlsrtlsyvteiapiyglrrslyeg
    fcmsfltlldhtsesllynhvvrftlgnrdqqnailkqipkvpdyiafchywlrrgqehy
    iitpfvqknllniaracstrmpiliqgptssgktsmieyvakktghkfvrinnhehtdlq
    evealrngywivldelnlaptdvlealnrllddnrelfipqvlvkphpefmlfatqnpgr
    khlsrafrnrfleihfeneletilhkrckpsyaakivqvfrelslrratlrdlfrwafre
    avgyqqlaengymllaerardqkdklavqeviekvmskvvwtrpmirlfclvwrcllake
    pvllvcgkttvcqilaeclhkelhiinahgdiigaqrpvrrsavnyslhsqlcekfiddl
    iekfeklnlierqiikhdgalvtamkdfflldeisladdsvlerlnsvlelsrtltlavs
    ltakdgfaffatmnpggkkelspalrnrfteiwvptedilkivegklhnnkielarplve
    yakwhaneylytdvisirdvlsavefinaceildlnlvlfnavsmvfidallaslhaerq
    rcfaklnelahtdttlmnaskvlralqvlkpillegspgvgktslitalaretghqlvri
    nlsdqtdlmdlfgsdapflaamrnghwvlldelnlasqsvleglnacldhrneayipeld
    kvfhpnfrvfaaqnpqglprsfinrfsvvyvalkekdmieiaacnyhqvnedwrlkiikf
    mfrlqdniekdisgspwefnlrdtlrwlqllndadylevmvlhrmrtvedrvrtcelfke
    vfdidyeprtigfslssqcfkvghsllvrdqktlldsqnilqsqlpvlesvitcinkkwp
    cilvgdtatgktcilrllaaiagakikemavnsdtdtmdlidisrkaselftdlsqqlln
    ivikyrnfdifretslytlttsqaftllqkvvdqldetlvhslgdihekarkllaefsas
    paggyllkaveeghwfvldnanlcspavldrlnsllelivnekttedghpktikphpnfr
    lfltvnpvygelsramrnrgveifllkealteidkkqmsllepapissavdtlasnisyi
    kyvfetmgnymyiahaiilalfsprqlkllrkvltlknlvqkiycadyfnhmdlkasrfm
    diyeypvqlrevvgliqtindfqsviltshlelpetyasgllfvsaheildlteevntyl
    lksasavygstpslwnllnqfskflieiassnivykldvirhflklvvlwkniyvwtsrf
    ycytkmlgewmftkllesflpkdslekfselqglhmqaiwdkwhafvprtydqwslwntv
    dklltqyvnasmettacevvgtslsllnkvlvenevgdiysylkilgkgvnelkssilpe
    nlvnlfnclasldllhifikyttssffltddfvrfirvcfhsrisgnlltllhfdfcslt
    tgnilgrialaftsanifeharlallqhfmdhssllaedsstkmnlillqryaviisifl
    dqgkcekandlitklslpyeelaenfvsileackaflvansefisytyterfihslrflq
    kmlknqgmayiyfasgmllvyvpdkpfdpatveslrhyleslykesqileiaeslnsgkv
    nsvmrrlvsteisnstvyrslnesivplyseleffmksvvlnqyifelamrlskesniav
    veeaksfvtkwkayierireaypqfvdvyelilsfisfmiygiellmfeakrrldersqi
    lstliltlvdpssfarsfddvsnlieqikvlndsirfeiylflasrlcsekqhssdthsl
    ansfvllanefyihnakikqkeleevvierkrflqlqfafwslyneiysekmnvipleql
    mntgsylakkikvknpdmiassgfdivsvvlmmgvkstnepskaievrdlikivesrais
    liknwpenfvlrglkdaidailnlspfspiaeylsklervfhllseweklasreyslane
    mdlikkkiidwrkfelsnwnnllkleeyklservyprlysilqfiilkpffftkqnlces
    asiivqfitdltvgefqlclkcllsfsqhaaslrichgidamllniyhyfeqflskvsea
    ihtqkqslensikerillmswkdtnvyalkesakkshaelfkvlhryrevlrqpvssyls
    qkhdwdslennsamwvakkvnlspsyiekteimklvpvrfsntpttlrlmwtlfanveks
    tftnmvsnlitdarelmkltpetinddnlseikhlksrkhllltetfktlkafglqyrvk
    agieenlsnlrnllaviptfpvlsiekvdrslmksldfipkfqtlaghqhndlvpevqkg
    vglfnsmlslqlgeraqlveftnellalknvysevydhdfenraqavsmlcqiyaiviqk
    hssfqsighelsrfadllsnklfpsadkvssirdqqkgindlieycrkkrtelpelsycf
    khlvslqslkdeflnlmnfvlnlfdsllssietatknmrtfkelaetssfiemsscfskv
    lrafnlkfqsmklsslkeklrsssvdkmscqllmlflpvceqfinlaesvldyfinvhns
    nldslskistlffmvannpskrtyqvmisiddsksmsesgstvlaletlalvtkalslle
    vgqiavmkfgeqpellhpfdkqfssesgvqmfshftfeqsntnvlaladasmkcfnyant
    ashhrsnsdirqleiiisdgicedhdsirkllrraqeekvmivfvildnvntqkkssild
    ikkvyydtkedgtmdlkiqpyidefafdyylvvrnieelpqllssalrqwfq