PDB entry 6ora

View 6ora on RCSB PDB site
Description: An Unexpected Intermediate in the Reaction Catalyzed by Quinolinate Synthase
Class: transferase
Keywords: biosynthesis, transferase
Deposited on 2019-04-29, released 2019-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthase A
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: nadA, PH0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57767 (0-End)
      • engineered mutation (197)
    Domains in SCOPe 2.08: d6oraa_
  • Chain 'B':
    Compound: Quinolinate synthase A
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: nadA, PH0013
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57767
      • engineered mutation (197)
    Domains in SCOPe 2.08: d6orab_
  • Heterogens: 5XR, 5XW, SF4, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6oraA (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpqcipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6oraA (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpqcipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6oraB (B:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpqcipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6oraB (B:)
    dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
    aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
    vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
    erakklhpnaklmihpqcipevqekadiiastggmikracewdewvvfteremvyrlrkl
    ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems