PDB entry 6oqq

View 6oqq on RCSB PDB site
Description: Legionella pneumophila SidJ/Saccharomyces cerevisiae calmodulin complex
Class: transferase
Keywords: polyglutamylation, pseudokinase, atypical kinase fold, TRANSFERASE
Deposited on 2019-04-28, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Legionella pneumophila SidJ
    Species: Legionella pneumophila [TaxId:446]
    Gene: SidJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CMD1, YBR109C, YBR0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6oqqb_
  • Chain 'C':
    Compound: Legionella pneumophila SidJ
    Species: Legionella pneumophila [TaxId:446]
    Gene: SidJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: calmodulin
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CMD1, YBR109C, YBR0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6oqqd_
  • Heterogens: AMP, POP, MG, NA, EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6oqqB (B:)
    mssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdg
    nhqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evddmlrevsdgsgeiniqqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6oqqB (B:)
    nlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgnhq
    iefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdaevd
    dminiqqfaalls
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6oqqD (D:)
    mssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdg
    nhqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evddmlrevsdgsgeiniqqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6oqqD (D:)
    lteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgnhqi
    efseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdaevdd
    mniqqfaalls