PDB entry 6oq4

View 6oq4 on RCSB PDB site
Description: Crystal Structure of the Ternary Complex of KRIT1 bound to both the Rap1 GTPase and HKi1
Class: cell adhesion
Keywords: Complex, Small molecules, GTPase, KRIT1, CELL ADHESION
Deposited on 2019-04-25, released 2020-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Krev interaction trapped protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KRIT1, CCM1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6oq4b_
  • Heterogens: N0G, MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6oq4B (B:)
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

    Sequence, based on observed residues (ATOM records): (download) 
    >6oq4B (B:)
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdlede
rvvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr