PDB entry 6opl

View 6opl on RCSB PDB site
Description: Human biliverdin IX beta reductase Q14R mutant: NADP complex
Class: oxidoreductase
Keywords: Human biliverdin IX beta reductase, short-chain dehydrogenase/reductase, oxidoreductase
Deposited on 2019-04-25, released 2020-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Flavin reductase (NADPH)
  Species: Homo sapiens [TaxId:9606]
  Gene: BLVRB, FLR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30043 (0-204)
    • engineered mutation (13)
  Domains in SCOPe 2.08: d6opla_
• Heterogens: NAP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6oplA (A:)
  mavkkiaifgatgrtglttlaqavqagyevtvlvrdssrlpsegprpahvvvgdvlqaad
  vdktvagqdavivllgtrndlspttvmsegarnivaamkahgvdkvvactsafllwdptk
  vpprlqavtddhirmhkvlresglkyvavmpphigdqpltgaytvtldgrgpsrviskhd
  lghfmlrclttdeydghstypshqy