PDB entry 6onn

View 6onn on RCSB PDB site
Description: Crystal structure of 8-amino-7-oxononanoate synthase from Burkholderia phymatum
Class: transferase
Keywords: SSGCID, 8-amino-7-oxononanoate synthase, Burkholderia phymatum, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2019-04-22, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: bioF, Bphy_0172
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JKH6 (8-401)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6onna1, d6onna2
  • Chain 'B':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: bioF, Bphy_0172
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JKH6 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6onnb1, d6onnb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6onnA (A:)
    mahhhhhhmqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylgl
    aahpllvaaitegarrygagsggshllgghsrahaqleddlaefaggfvdnpralyfstg
    ymanlatltalagrgttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaa
    vklivsdtvfsmdgdiaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsp
    hlivvgtlgkaagvsgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggd
    egehrrahlrslialtrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvp
    airpptvpegtsrlrislsaahshndleqlehalmktaeara
    

    Sequence, based on observed residues (ATOM records): (download)
    >6onnA (A:)
    hhmqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylglaahpll
    vaaitegarrygagsgghsrahaqleddlaefaggfvdnpralyfstgymanlatltala
    grgttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaavklivsdtvfsm
    dgdiaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsphlivvgtlgkaa
    gvsgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggdegehrrahlrsl
    ialtrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvpairpptvpegts
    rlrislsaahshndleqlehalmktaeara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6onnB (B:)
    mahhhhhhmqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylgl
    aahpllvaaitegarrygagsggshllgghsrahaqleddlaefaggfvdnpralyfstg
    ymanlatltalagrgttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaa
    vklivsdtvfsmdgdiaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsp
    hlivvgtlgkaagvsgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggd
    egehrrahlrslialtrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvp
    airpptvpegtsrlrislsaahshndleqlehalmktaeara
    

    Sequence, based on observed residues (ATOM records): (download)
    >6onnB (B:)
    hhmqlldtleqglkeidarglrrrrrtvdspcsahmtvdgrnmigfasndylglaahpll
    vaaitegarrygagsggshllgghsrahaqleddlaefaggfvdnpralyfstgymanla
    tltalagrgttlfsdslnhaslidgarlsradiqiyphadaealgamleasdaavklivs
    dtvfsmdgdiaplarllelaehhgawlvvddahgfgvlgpqgrgavaeaalrsphlivvg
    tlgkaagvsgafvvahetviewlvqrarpyifttasvpsaahavsaslriiggdegehrr
    ahlrslialtrdmlkstpwlpvdshtavqpliigsneatldvaasldranlwvpairppt
    vpegtsrlrislsaahshndleqlehalmktae