PDB entry 6ona

View 6ona on RCSB PDB site
Description: Crystal structure of Influenza hemagglutinin from strain A/Hickox/JY2/1940
Class: viral protein
Keywords: Inflenza hemagglutinin, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2019-04-20, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hickox/1940 H1N1) [TaxId:383543]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6onaa1, d6onaa2, d6onaa3
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hickox/1940 H1N1) [TaxId:383543]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6onab1, d6onab2, d6onab3
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hickox/1940 H1N1) [TaxId:383543]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6onac1, d6onac2, d6onac3
  • Heterogens: NAG, BMA, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6onaA (A:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kerswpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwg
    vhhpsnienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpf
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwagmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmes
    vkngtydypkyseeflvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6onaA (A:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniag
    wilgnpeceslrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpkers
    wpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwgvhhp
    snienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdtiif
    eangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpftige
    cpkyvrstklrmvtglrnipglfgaiagfieggwagmidgwygyhhqneqgsgyaadqks
    tqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynaellv
    llenertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmesvkngtydy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6onaB (B:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kerswpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwg
    vhhpsnienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpf
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwagmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmes
    vkngtydypkyseeflvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6onaB (B:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniag
    wilgnpeckrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpkerswp
    nhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwgvhhpsn
    ienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdtiifea
    ngnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpftigecp
    kyvrstklrmvtglrnipglfgaiagfieggwagmidgwygyhhqneqgsgyaadqkstq
    naingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynaellvll
    enertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmesvkngtydypky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6onaC (C:)
    gsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcnia
    gwilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifp
    kerswpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwg
    vhhpsnienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgd
    tiifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpf
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwagmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmes
    vkngtydypkyseeflvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6onaC (C:)
    sdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniag
    wilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpk
    erswpnhninigvtaacshagkssfyknllwltekdgsypnlnksyvnkkekevlvlwgv
    hhpsnienqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdt
    iifeangnliapwyafalsrglgsgiitsnasmdecdtkcqtpqgainsslpfqnihpft
    igecpkyvrstklrmvtglrnipglfgaiagfieggwagmidgwygyhhqneqgsgyaad
    qkstqnaingitnkvnsviekmntqftavgkefnklekrmenlnkkvddgfldiwtynae
    llvllenertldfhdsnvknlyekvknqlrnnakeigngcfefyhkcnnecmesvkngty
    dypky