PDB entry 6ohx

View 6ohx on RCSB PDB site
Description: Solution structure of scorpion Hottentotta jayakari venom toxin Hj1a
Class: toxin
Keywords: Sodium-gated ion channel, TOXIN
Deposited on 2019-04-08, released 2020-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Venom toxin Hj1a
  Species: Hottentotta jayakari [TaxId:224597]
  Database cross-references and differences (RAF-indexed):
  • PDB 6OHX (0-66)
  Domains in SCOPe 2.08: d6ohxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ohxA (A:)
  geevrdayiaqphncvyhcfrdsycndlcikhgaesgeckwftssgnacwcvklpksepi
  kvpgkch