PDB entry 6ohd

View 6ohd on RCSB PDB site
Description: P38 in complex with T-3220137
Class: transferase/inhibitor
Keywords: SBDD, P38, kinase, PROTEIN BINDING, TRANSFERASE-INHIBITOR complex
Deposited on 2019-04-05, released 2019-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • conflict (146)
      • conflict (189)
    Domains in SCOPe 2.07: d6ohda_
  • Heterogens: MKP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ohdA (A:)
    msyyhhhhhhdydipttenlyfqgamgsmsqerptfyrqelnktiwevperyqnlspvgs
    gaygsvcaafdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftp
    arsleefndvylvthlmgadlnnivksqkltddhvqfliyqilrglkyihsadiihrdlk
    psnlavnedselkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgci
    maelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfan
    vfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdl
    lidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ohdA (A:)
    erptfyrqelnktiwevperyqnlspvsvcaafdtktglrvavkklsrpfqsiihakrty
    relrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedselkildfglaratrwyrapeimlhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    tqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
    ydqsfesrdllidewksltydevisfvppp