PDB entry 6of8

View 6of8 on RCSB PDB site
Description: Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CamKII-alpha hub domain
Class: transferase
Keywords: CaMKII hub domain, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2019-03-28, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (4-End)
      • expression tag (1-3)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8a1, d6of8a2
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (4-End)
      • expression tag (2-3)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8b1, d6of8b2
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (4-End)
      • expression tag (2-3)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8c1, d6of8c2
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (4-End)
      • expression tag (2-3)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8d1, d6of8d2
  • Chain 'E':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (Start-134)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8e_
  • Chain 'F':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8f_
  • Chain 'G':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (4-End)
      • expression tag (2-3)
      • engineered mutation (13-14)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6of8g1, d6of8g2
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6of8A (A:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8A (A:)
    phmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfen
    lwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgk
    wqhvhmhrsga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6of8B (B:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8B (B:)
    hmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenl
    wsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkw
    qhvhmhrsga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6of8C (C:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8C (C:)
    hmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenl
    wsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkw
    qhvhmhrsga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6of8D (D:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8D (D:)
    hmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenl
    wsskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqh
    vhmhrsgaps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6of8E (E:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8E (E:)
    rkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlwsr
    nskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqhv
    hmhrsgapsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6of8F (F:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8F (F:)
    rkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlwsr
    nskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqhv
    hmhrsgap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6of8G (G:)
    gphmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlwsrnskpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqhvhmhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of8G (G:)
    hmvrkqeiikvnqqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenl
    wpvhntmlnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqhvhm
    hrsga