PDB entry 6of7

View 6of7 on RCSB PDB site
Description: Crystal structure of the CRY1-PER2 complex
Class: circadian clock protein
Keywords: Cryptochrome-1, Period 2 complex, CIRCADIAN CLOCK PROTEIN
Deposited on 2019-03-28, released 2020-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome-1
    Species: Mus musculus [TaxId:10090]
    Gene: CRY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6of7a1, d6of7a2
  • Chain 'B':
    Compound: Period circadian protein homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PER2, KIAA0347
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6of7A (A:)
    mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
    dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
    gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
    plsddhdekygvpsleelgfdtdglssavwpggetealtrlerhlerkawvanferprmn
    ansllasptglspylrfgclscrlfyfkltdlykkvkknsspplslygqllwreffytaa
    tnnprfdkmegnpicvqipwdknpealakwaegrtgfpwidaimtqlrqegwihhlarha
    vacfltrgdlwisweegmkvfeellldadwsinagswmwlscssffqqffhcycpvgfgr
    rtdpngdyirrylpvlrgfpakyiydpwnapegiqkvakcligvnypkpmvnhaeasrln
    iermkqiyqql
    

    Sequence, based on observed residues (ATOM records): (download)
    >6of7A (A:)
    vnavhwfrkglrlhdnpalkeciqgadtircvyildssnvginrwrfllqcledldanlr
    klnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivr
    ishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtplsddhd
    ekygvpsleelgfdtdglssavwpggetealtrlerhlerkansllasptglspylrfgc
    lscrlfyfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqip
    wdknpealakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmk
    vfeellldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgf
    pakyiydpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql
    

  • Chain 'B':
    No sequence available.