PDB entry 6ocg

View 6ocg on RCSB PDB site
Description: crystal structure of vash1-svbp complex bound with epoy
Deposited on 2019-03-23, released 2019-06-26
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulinyl-Tyr carboxypeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: VASH1, KIAA1036, VASH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Small vasohibin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SVBP, CCDC23
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, BJL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ocgA (A:)
pffvnrgglpvdeatwermwkhvakihpdgekvaqrirgatdlpkipipsvptfqpstpv
perleavqryirelqynhtgtqffeikksrpltglmdlakemtkealpikcleavilgiy
ltnsmptlerfpisfktyfsgnyfrhivlgvnfagrygalgmsrredlmykppafrtlse
lvldfeaaygrcwhvlkkvklgqsvshdphsveqiewkhsvldverlgrddfrkelerha
rdmrlki

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ocgB (B:)
saqqelkqrqraeiyalnrvmteleq