PDB entry 6obk

View 6obk on RCSB PDB site
Description: nmr structure of orf47 from lactococcus virus p2
Deposited on 2019-03-21, released 2020-04-01
The last revision was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein ORF47
    Species: Lactococcus phage p2, synthetic [TaxId:254252]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6obkA (A:)
    mnkehilaqkevltpieyehyvkhlfdigeitkelyielssdl