PDB entry 6ob1

View 6ob1 on RCSB PDB site
Description: Structure of WHB in complex with Ubiquitin Variant
Class: protein binding
Keywords: Ubiquitin, WHB, PROTEIN BINDING
Deposited on 2019-03-19, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6OB1 (0-18)
    • PDB 6OB1 (19-74)
    Domains in SCOPe 2.07: d6ob1a_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6OB1 (0-74)
    Domains in SCOPe 2.07: d6ob1b_
  • Chain 'C':
    Compound: Anaphase-promoting complex subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC2, APC2, KIAA1406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJX6 (2-89)
      • expression tag (0-1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ob1A (A:)
    gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkesalillltlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ob1B (B:)
    gmqifvdtvqwktitlevepsdtienvkakiqdkegippdqqrldfagkqledgrtlsdy
    niqkesalillltlr
    

  • Chain 'C':
    No sequence available.