PDB entry 6o56

View 6o56 on RCSB PDB site
Description: hnh nuclease from s. pyogenes cas9
Deposited on 2019-03-01, released 2020-01-15
The last revision was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crispr-associated endonuclease cas9/csn1
    Species: Streptococcus pyogenes serotype M1 [TaxId:301447]
    Gene: cas9, csn1, SPy_1046
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99ZW2 (1-134)
      • expression tag (0)
  • Chain 'B':
    Compound: crispr-associated endonuclease cas9/csn1
    Species: Streptococcus pyogenes serotype M1 [TaxId:301447]
    Gene: cas9, csn1, SPy_1046
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99ZW2 (1-134)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6o56A (A:)
sknsrermkrieegikelgsqilkehpventqlqneklylyylqngrdmyvdqeldinrl
sdydvdhivpqsflkddsidnkvltrsdknrgksdnvpseevvkkmknywrqllnaklit
qrkfdnltkaerggl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6o56B (B:)
sknsrermkrieegikelgsqilkehpventqlqneklylyylqngrdmyvdqeldinrl
sdydvdhivpqsflkddsidnkvltrsdknrgksdnvpseevvkkmknywrqllnaklit
qrkfdnltkaerggl