PDB entry 6o54

View 6o54 on RCSB PDB site
Description: Crystal Structure of multi-drug resistant HIV-1 protease PR-S17 (D25N)
Class: HYDROLASE, Viral Protein
Keywords: HIV PROTEASE, HYDROLASE, Viral Protein
Deposited on 2019-03-01, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot I7BFC3 (0-98)
      • engineered mutation (24)
      • engineered mutation (45)
      • engineered mutation (47)
      • engineered mutation (66)
      • engineered mutation (76)
      • engineered mutation (81)
      • engineered mutation (92)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d6o54x_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6o54X (X:)
pqitlwqrpivtikiggqlreallntgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf