PDB entry 6o44

View 6o44 on RCSB PDB site
Description: Insight into subtilisin E-S7 cleavage pattern based on crystal structure and hydrolysates peptide analysis
Class: hydrolase
Keywords: subtilisin, HYDROLASE
Deposited on 2019-02-28, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nattokinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: aprN
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024B5N4 (0-274)
      • engineered mutation (220)
      • expression tag (275)
    Domains in SCOPe 2.07: d6o44a1, d6o44a2
  • Chain 'B':
    Compound: Nattokinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: aprN
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024B5N4 (0-274)
      • engineered mutation (220)
      • expression tag (275)
    Domains in SCOPe 2.07: d6o44b1, d6o44b2
  • Heterogens: CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6o44A (A:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
    nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaqslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o44A (A:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
    nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6o44B (B:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
    nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaqslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6o44B (B:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
    nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaqs