PDB entry 6o36

View 6o36 on RCSB PDB site
Description: Crystal structure of human KRAS P34R mutant in complex with GNP
Class: hydrolase
Keywords: HYDROLASE, small GTPase, signal transduction, GNP binding
Deposited on 2019-02-26, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-167)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d6o36a_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-167)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d6o36b_
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-167)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d6o36c_
  • Heterogens: MG, PO4, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o36A (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydrtiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o36B (B:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydrtiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6o36C (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydrtiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke