PDB entry 6o2f

View 6o2f on RCSB PDB site
Description: gcn4 with npeg4 at position 18
Deposited on 2019-02-22, released 2019-06-26
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), synthetic [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-30)
    • engineered mutation (17)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6o2fA (A:)
  rmkqledkveellsknynlenevarlkklvg