PDB entry 6o1q

View 6o1q on RCSB PDB site
Description: the n-terminal domain of nphp1 folds into an antiparallel three- stranded coiled coil
Deposited on 2019-02-21, released 2019-08-14
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nephrocystin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: NPHP1, NPH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15259 (4-118)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6o1qA (A:)
gpmamlarrqrdplqalrrrnqelkqqvdsllsesqlkealepnkrqhiyqrciqlkqai
denknalqklskadesapvanynqrkeeehtlldkltqqlqglavtisrenitevgapt