PDB entry 6nz2

View 6nz2 on RCSB PDB site
Description: nmr solution structure of bcd1p120-303 from saccharomyces cerevisiae
Deposited on 2019-02-12, released 2020-08-19
The last revision was dated 2021-09-08, with a file datestamp of 2021-09-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Box C/D snoRNA protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: BCD1, YHR040W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38772 (4-187)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6nz2A (A:)
gphmrdstecqriirrgvnclmlpkgmqrssqnrskwdktmdlfvwsvewilcpmqekge
kkelfkhvshriketdflvqgmgknvfqkccefyrlagtssciegedgsetkeertqilq
ksglkfytktfpyntthimdskklvelaihekcigellknttviefptifvamteadlpe
gyevlhqe