PDB entry 6nyo

View 6nyo on RCSB PDB site
Description: Crystal structure of a human Cdc34-ubiquitin thioester mimetic
Class: ligase/transferase
Keywords: CONFORMATIONAL CHANGE, THIOESTER, ADENYLATION, THIOESTER TRANSFER, TRANSTHIOESTERIFICATION, ATP-BINDING, UBIQUITIN E2-BINDING, UBIQUITINATION, LIGASE, LIGASE-TRANSFERASE complex
Deposited on 2019-02-11, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 R2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2R2, CDC34B, UBC3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q712K3
      • engineered mutation (94)
    Domains in SCOPe 2.07: d6nyoa_
  • Chain 'E':
    Compound: Ubiquitin
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NYO (Start-95)
    Domains in SCOPe 2.07: d6nyoe1, d6nyoe2
  • Heterogens: U94, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nyoA (A:)
    gamaqqqmtssqkalmlelkslqeepvegfritlvdesdlynwevaifgppntlyeggyf
    kahikfpidypyspptfrfltkmwhpniyengdvkisilhppvddpqsgelpserwnptq
    nvrtillsvisllnepntfspanvdasvmfrkwrdskgkdkeyaeiirkqvsatkaeaek
    dgvkvpttlaeyciktkvpsndns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nyoA (A:)
    qmtssqkalmlelkslqeepvegfritlvdesdlynwevaifgppntlyeggyfkahikf
    pidypyspptfrfltkmwhpniyengdvkisilhppvddpqsgelpserwnptqnvrtil
    lsvisllnepntfspanvdasvmfrkwrdskgkdkeyaeiirkqvsatkaeaekdgvkvp
    ttlaeyci
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6nyoE (E:)
    mgsshhhhhhssglvprgshmqifvktltgktitlevessdtidnvkskiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nyoE (E:)
    shmqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrgg