PDB entry 6nyc

View 6nyc on RCSB PDB site
Description: Munc13-1 C2B-domain, calcium free
Class: metal binding protein
Keywords: phospholipid binding protein, metal binding protein
Deposited on 2019-02-11, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Munc13-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Unc13a, Unc13h1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62768
      • engineered mutation (83)
    Domains in SCOPe 2.07: d6nyca_
  • Heterogens: CL, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nycA (A:)
    efavkqsvldgtskwsakisitvvcaqglqakdktgssdpyvtvqvgktkkrtktiygnl
    npvweenfhfechnssdrikvrvwdedddiksrvkqrfkresddflgqtiievrtlsgem
    dvwynldkrtdksavsgairlhisveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nycA (A:)
    wsakisitvvcaqglqakdgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechnss
    drikvrvwdedddikesddflgqtiievrtlsgemdvwynldkrvsgairlhisvei