PDB entry 6ny0

View 6ny0 on RCSB PDB site
Description: Crystal structure of trimethoprim-resistant type II dihydrofolate reductase in complex with a bisbenzimidazole inhibitor
Class: oxidoreductase
Keywords: antibiotic resistance; selective inhibitor; R67 DHFR; SH3-like barrel, ANTIBIOTIC, OXIDOREDUCTASE
Deposited on 2019-02-10, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00383 (Start-60)
      • conflict (3)
    Domains in SCOPe 2.07: d6ny0a_
  • Heterogens: LBA, MRD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ny0A (A:)
    fpsdatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaleri
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ny0A (A:)
    datfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin