PDB entry 6nxz

View 6nxz on RCSB PDB site
Description: Crystal structure of trimethoprim-resistant type II dihydrofolate reductase in complex with a bisbenzimidazole inhibitor
Class: oxidoreductase
Keywords: antibiotic resistance; selective inhibitor; R67 DHFR; SH3-like barrel, ANTIBIOTIC, OXIDOREDUCTASE
Deposited on 2019-02-10, released 2019-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dihydrofolate reductase type 2
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00383
  Domains in SCOPe 2.08: d6nxza_
• Heterogens: D49, MRD, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6nxzA (A:)
  vfpsdatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
  in
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6nxzA (A:)
  atfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaleri