PDB entry 6nwv

View 6nwv on RCSB PDB site
Description: insulin lispro analog
Deposited on 2019-02-07, released 2020-02-12
The last revision was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
    • engineered mutation (27)
• Chain 'C':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (27-28)
• Chain 'E':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'F':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (27-28)
• Chain 'G':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'H':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (27-28)
• Chain 'I':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'J':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308
    • engineered mutation (27)
• Chain 'K':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'L':
  Compound: Insulin Lispro B chain
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (27-28)
• Heterogens: CRS, ZN, GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6nwvB (B:)
  fvnqhlcgshlvealylvcgergffytkpt
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6nwvB (B:)
  fvnqhlcgshlvealylvcgergffytk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvD (D:)
  fvnqhlcgshlvealylvcgergffytkpt
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvF (F:)
  fvnqhlcgshlvealylvcgergffytkpt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvH (H:)
  fvnqhlcgshlvealylvcgergffytkpt
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvI (I:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'J':
  Sequence, based on SEQRES records:
  

  >6nwvJ (J:)
  fvnqhlcgshlvealylvcgergffytkpt
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6nwvJ (J:)
  nqhlcgshlvealylvcgergffytk
  

  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvK (K:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records:
  

  >6nwvL (L:)
  fvnqhlcgshlvealylvcgergffytkpt