PDB entry 6nwk

View 6nwk on RCSB PDB site
Description: structure of the ancestral glucocorticoid receptor 2 ligand binding domain in complex with dexamethasone and pgc1a coregulator fragment
Deposited on 2019-02-06, released 2019-10-23
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6NWK (0-248)
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DEX, FMT, ACE, DMS, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6nwkA (A:)
fptlislleviepevlysgydstlpdtstrlmstlnrlggrqvvsavkwakalpgfrnlh
lddqmtllqyswmslmafslgwrsykqsngnmlcfapdlvineermqlpymydqcqqmlk
issefvrlqvsydeylcmkvllllstvpkdglksqavfdeirmtyikelgkaivkregns
sqnwqrfyqltklldsmhemvggllqfcfytfvnkslsvefpemlaeiisnqlpkfkags
vkpllfhqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6nwkB (B:)
psllkklllapa