PDB entry 6nwc

View 6nwc on RCSB PDB site
Description: pyl10 bound to the aba pan-agonist 3cb
Deposited on 2019-02-06, released 2019-11-06
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abscisic acid receptor PYL10
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PYL10, RCAR4, At4g27920, T13J8.30
    Database cross-references and differences (RAF-indexed):
  • Heterogens: L6P, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6nwcA (A:)
sqcsstlvkhikaplhlvwsivrrfdepqkykpfisrcvvqgkklevgsvrevdlksglp
atkstevleilddnehilgirivggdhrlknysstislhsetidgktgtlaiesfvvdvp
egntkeetcffvealiqcnlnsladvterlqaesm