PDB entry 6nuu

View 6nuu on RCSB PDB site
Description: Structure of Calcineurin mutant in complex with NHE1 peptide
Class: HYDROLASE/Calcium Binding Protein
Keywords: Ser/thr phosphatase, complex, HYDROLASE, HYDROLASE-Calcium Binding Protein complex
Deposited on 2019-02-02, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3CA, CALNA, CNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08209 (Start-371)
      • engineered mutation (156)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d6nuua_
  • Chain 'B':
    Compound: Calcineurin subunit B type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3R1, CNA2, CNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63098 (1-155)
      • expression tag (0)
    Domains in SCOPe 2.07: d6nuub1, d6nuub2
  • Chain 'C':
    Compound: sodium/hydrogen exchanger 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC9A1, APNH1, NHE1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, ZN, PO4, PEG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nuuA (A:)
    ghmsepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrlee
    svalriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgd
    yvdrgyfsiecvlylwalkilypktlfllrgnhecralteaftfkqeckikyservydac
    mdafdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpled
    fgnektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttg
    fpslitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvg
    ekvtemlvnvln
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nuuA (A:)
    klsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitega
    silrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiec
    vlylwalkilypktlfllrgnhecralteaftfkqeckikyservydacmdafdclplaa
    lmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehft
    hntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsap
    nyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvl
    n
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6nuuB (B:)
    mdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfke
    fiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivd
    ktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

  • Chain 'C':
    No sequence available.