PDB entry 6nur

View 6nur on RCSB PDB site
Description: SARS-Coronavirus NSP12 bound to NSP7 and NSP8 co-factors
Class: viral protein
Keywords: coronavirus, polymerase, non-structural protein, VIRAL PROTEIN
Deposited on 2019-02-01, released 2019-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nsp12
  Species: Human SARS coronavirus [TaxId:227859]
  Gene: rep, 1a-1b
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6X7
• Chain 'B':
  Compound: nsp8
  Species: Human SARS coronavirus [TaxId:227859]
  Gene: 1a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6U8
  Domains in SCOPe 2.08: d6nurb_
• Chain 'C':
  Compound: nsp7
  Species: Human SARS coronavirus [TaxId:227859]
  Gene: rep, 1a-1b
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6X7
• Chain 'D':
  Compound: nsp8
  Species: Human SARS coronavirus [TaxId:227859]
  Gene: 1a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6U8
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6nurB (B:)
  aiasefsslpsyaayataqeayeqavangdsevvlkklkkslnvaksefdrdaamqrkle
  kmadqamtqmykqarsedkrakvtsamqtmlftmlrkldndalnniinnardgcvplnii
  plttaaklmvvvpdygtykntcdgntftyasalweiqqvvdadskivqlseinmdnspnl
  awplivtalransavklq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6nurB (B:)
  edkrakvtsamqtmlftmlrkldndalnniinnardgcvplniiplttaaklmvvvpdyg
  tykntcdgntftyasalweiqqvvdadskivqlseinmdnspnlawplivtalra
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.