PDB entry 6ntp

View 6ntp on RCSB PDB site
Description: PTP1B Domain of PTP1B-LOV2 Chimera
Class: hydrolase
Keywords: Protein tyrosine phosphatase, protein phosphorylation, signaling, diabetes, obesity, cancer, HYDROLASE
Deposited on 2019-01-30, released 2020-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 1,NPH1-1
    Species: AVENA SATIVA [TaxId:4498]
    Gene: NPH1-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ntpa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ntpA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedaa
    tlerieknfvitdprlpdnpiifasdsflqlteysreeilgrncrflqgpetdratvrki
    rdaidnqtevtvqlinytksgkkfwnlfhlqpmrdqkgdvqyfigvqldgtehvrdaaer
    egvmlikktaenideaakellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ntpA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim