PDB entry 6ntf

View 6ntf on RCSB PDB site
Description: Crystal structure of a computationally optimized H5 influenza hemagglutinin
Class: viral protein
Keywords: vaccine, influenza, VIRAL PROTEIN
Deposited on 2019-01-29, released 2019-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6NTF (0-End)
    Domains in SCOPe 2.07: d6ntfa1, d6ntfa2
  • Heterogens: NAG, PEG, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ntfA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpandlcfpgnfndyeelkhllsrinhfekiqiipks
    swsdheassgvssacpyqgspsffrnvvwlikknntyptikrsynntnqedllvlwgihh
    pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihpltig
    ecpkyvksnrlvlatglrnspqresrrkkrglfgaiagfieggwqgmvdgwygyhhsneq
    gsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefnnlerrienlnkkmedgfld
    vwtynaellvlmenertldfhdsnvknlydkvrlqlrdnakelgngcfefyhkcdnecme
    svrngtydypqyseearlkreeisgvgyipeaprdgqayvrkdgewvllstflgsglndi
    feaqkiewheghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ntfA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpandlcfpgnfndyeelkhllsrinhfekiqiipks
    swsdheassgvssacpyqgspsffrnvvwlikknntyptikrsynntnqedllvlwgihh
    pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsplfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkes
    tqkaidgvtnkvnsiidkmntqfeavgrefnnlerrienlnkkmedgfldvwtynaellv
    lmenertldfhdsnvknlydkvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
    qyseearlkre