PDB entry 6nrx

View 6nrx on RCSB PDB site
Description: crystal structure of dip-eta ig1 homodimer
Deposited on 2019-01-24, released 2019-02-06
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dpr-interacting protein eta, isoform B
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DIP-eta, 14010, CT33567, DmelCG14010, CG14010, Dmel_CG14010
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VMN9 (2-105)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Dpr-interacting protein eta, isoform B
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DIP-eta, 14010, CT33567, DmelCG14010, CG14010, Dmel_CG14010
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VMN9 (2-105)
      • expression tag (0-1)
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6nrxA (A:)
srivdpkfsspivnmtapvgrdafltcvvqdlgpykvawlrvdtqtiltiqnhvitknqr
igiansehktwtmrikdikesdkgwymcqintdpmksqmgyldvvvhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6nrxA (A:)
srivdpkfsspivnmtapvgrdafltcvvqdlgpykvawlrvdtqtiltiqnhvitknqr
igiansehktwtmrikdikesdkgwymcqintdpmksqmgyldvvv

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6nrxB (B:)
srivdpkfsspivnmtapvgrdafltcvvqdlgpykvawlrvdtqtiltiqnhvitknqr
igiansehktwtmrikdikesdkgwymcqintdpmksqmgyldvvvhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6nrxB (B:)
srivdpkfsspivnmtapvgrdafltcvvqdlgpykvawlrvdtqtiltiqnhvitknqr
igiansehktwtmrikdikesdkgwymcqintdpmksqmgyldvvv