PDB entry 6nr1

View 6nr1 on RCSB PDB site
Description: The X-ray crystal structure of Streptococcus pneumoniae Fatty Acid Kinase (Fak) B2 protein loaded with Vaccenic acid (C18:1 delta11) to 2.1 Angstrom resolution
Class: transferase
Keywords: Streptococcus pneumoniae, Fatty acid kinase, Vaccenic acid, TRANSFERASE
Deposited on 2019-01-22, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty Acid Kinase (Fak) B2 protein (SPR1019)
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SPR1019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nr1a_
  • Chain 'B':
    Compound: Fatty Acid Kinase (Fak) B2 protein (SPR1019)
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SPR1019
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6nr1b_
  • Heterogens: VCA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6nr1A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpmtkikivtdssvtiepelvkqlditi
    vplsvmidnvvysdadlkeegkflqlmqesknlpktsqppvgvfaeifedlckdggqila
    ihmshalsgtveaarqgaslstadvivvdssftdqalkfqvveaaklaqegkdmeailsh
    veevknhtelyigvstlenlvkggrigrvtgllssllnirvvmqmkdhelqpmvkgrgtk
    tfkkwldelitslseravaeigisysgsddwakemkeslqayvekpisvletgsiiqtht
    genawailiryhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nr1A (A:)
    mtkikivtdssvtiepelvkqlditivplsvmidnvvysdadlkeegkflqlmqesknlp
    ktsqppvgvfaeifedlckdggqilaihmshalsgtveaarqgaslstadvivvdssftd
    qalkfqvveaaklaqegkdmeailshveevknhtelyigvstlenlvkggrigrvtglls
    sllnirvvmqmkdhelqpmvkgrgtktfkkwldelitslseravaeigisysgsddwake
    mkeslqayvekpisvletgsiiqthtgenawailiryhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6nr1B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpmtkikivtdssvtiepelvkqlditi
    vplsvmidnvvysdadlkeegkflqlmqesknlpktsqppvgvfaeifedlckdggqila
    ihmshalsgtveaarqgaslstadvivvdssftdqalkfqvveaaklaqegkdmeailsh
    veevknhtelyigvstlenlvkggrigrvtgllssllnirvvmqmkdhelqpmvkgrgtk
    tfkkwldelitslseravaeigisysgsddwakemkeslqayvekpisvletgsiiqtht
    genawailiryhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6nr1B (B:)
    tkikivtdssvtiepelvkqlditivplsvmidnvvysdadlkeegkflqlmqesknlpk
    tsqppvgvfaeifedlckdggqilaihmshalsgtveaarqgaslstadvivvdssftdq
    alkfqvveaaklaqegkdmeailshveevknhtelyigvstlenlvkggrigrvtgllss
    llnirvvmqmkdhelqpmvkgrgtktfkkwldelitslseravaeigisysgsddwakem
    keslqayvekpisvletgsiiqthtgenawailiryhs