PDB entry 6npp

View 6npp on RCSB PDB site
Description: Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
Class: viral protein/inhibitor
Keywords: EBNA1, DNA binding protein, Epstein-Barr Virus, viral protein, viral protein-inhibitor complex
Deposited on 2019-01-18, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03211 (4-140)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6nppa1, d6nppa2
  • Chain 'B':
    Compound: ebna1
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: EBNA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0P0J719 (0-133)
      • conflict (13)
      • conflict (25)
      • conflict (28)
      • conflict (50)
      • conflict (54)
      • conflict (59)
      • conflict (120)
    Domains in SCOPe 2.08: d6nppb_
  • Heterogens: KWG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6nppA (A:)
shmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtal
aipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtk
paptcnirvtvcsfddgvdlp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6nppB (B:)
snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
rvtvcsfddgvdlp