PDB entry 6npi

View 6npi on RCSB PDB site
Description: Crystal structure of Epstein-Barr Virus Nuclear Antigen-1, EBNA1, bound to fragments
Class: viral protein/inhibitor
Keywords: EBNA1, DNA binding protein, Epstein-Barr Virus, viral protein, viral protein-inhibitor complex
Deposited on 2019-01-17, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03211 (4-140)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d6npia1, d6npia2
  • Chain 'B':
    Compound: Epstein-Barr nuclear antigen 1
    Species: Epstein-Barr virus (strain B95-8) [TaxId:10377]
    Gene: EBNA1, BKRF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6npib_
  • Heterogens: 60Q, KW1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6npiA (A:)
    shmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtal
    aipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtk
    paptcnirvtvcsfddgvdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6npiA (A:)
    hmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtala
    ipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkp
    aptcnirvtvcsfddgvdlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6npiB (B:)
    shmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtal
    aipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtk
    paptcnirvtvcsfddgvdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6npiB (B:)
    snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
    tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
    rvtvcsfddgvdlp