PDB entry 6np9

View 6np9 on RCSB PDB site
Description: PD-L1 IgV domain V76T with fragment
Class: immune system
Keywords: Fragment-based screening, Structure-based design, PD-L1 inhibitor, Cancer drug discovery, Immunotherapy, IMMUNE SYSTEM
Deposited on 2019-01-17, released 2019-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death 1 ligand 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZQ7 (0-116)
      • engineered mutation (58)
      • expression tag (117-123)
    Domains in SCOPe 2.08: d6np9a1, d6np9a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6np9A (A:)
    aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlktq
    hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapyaaa
    lhehhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6np9A (A:)
    aftvtvpkdlyvveygsnmtieckfpvqldlaalivywemedkniiqfvhgeedlktqhs
    syrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapyaaalh
    eh